This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PDCD1 monoclonal antibody (M01), clone 3B2
catalog :
H00005133-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B2
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005133-M01
product name :
PDCD1 monoclonal antibody (M01), clone 3B2
product description :
Mouse monoclonal antibody raised against a partial recombinant PDCD1.
clone name :
3B2
isotype :
IgG1 Kappa
gene name :
PDCD1
gene alias :
CD279 PD1 SLEB2 hPD-1 hPD-l
gene description :
programmed cell death 1
genbank accession :
BC074740.2
immunogen :
PDCD1 (AAH74740.1, 33 a.a. ~ 145 a.a) partial recombinant protein.
immunogen sequence protein sequence :
NPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMS
PSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
VRARRNDSGTYLCGAISLAPKAQIKESLRAELRVT
PSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
VRARRNDSGTYLCGAISLAPKAQIKESLRAELRVT
protein accession :
AAH74740.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2015-07-27
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
