This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PAX3 monoclonal antibody (M05), clone 4F4
catalog :
H00005077-M05
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4F4
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005077-M05
product name :
PAX3 monoclonal antibody (M05), clone 4F4
product description :
Mouse monoclonal antibody raised against a partial recombinant PAX3.
clone name :
4F4
isotype :
IgG2b Kappa
gene name :
PAX3
gene alias :
CDHS HUP2 MGC120381 MGC120382 MGC120383 MGC120384 MGC134778 WS1
gene description :
paired box 3
genbank accession :
NM_181457
immunogen :
PAX3 (NP_852122, 307 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIP
SNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTI
GNGLSPQVMGLLTNHGGVPHQPQTDYALSP
SNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTI
GNGLSPQVMGLLTNHGGVPHQPQTDYALSP
protein accession :
NP_852122
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2007-10-29
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
