This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SERPINB2 monoclonal antibody (M08), clone 3A9
catalog :
H00005055-M08
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3A9
reactivity :
human
application :
western blot, ELISA, immunoprecipitation
product information
catalog id :
H00005055-M08
product name :
SERPINB2 monoclonal antibody (M08), clone 3A9
product description :
Mouse monoclonal antibody raised against a partial recombinant SERPINB2.
clone name :
3A9
isotype :
IgG2b Kappa
gene name :
SERPINB2
gene alias :
HsT1201 PAI PAI-2 PAI2 PLANH2
gene description :
serpin peptidase inhibitor, clade B (ovalbumin), member 2
genbank accession :
BC012609
immunogen :
SERPINB2 (AAH12609, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTM
AMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTS
CGFMQQIQKGSYPDAILQAQAA
AMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFTS
CGFMQQIQKGSYPDAILQAQAA
protein accession :
AAH12609
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,S-ELISA,ELISA,IP
size :
100 ug
autodate :
2007-01-12
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
