This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PA2G4 MaxPab rabbit polyclonal antibody (D01)
catalog :
H00005036-D01
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunocytochemistry, immunoprecipitation
product information
catalog id :
H00005036-D01
product name :
PA2G4 MaxPab rabbit polyclonal antibody (D01)
product description :
Rabbit polyclonal antibody raised against a full-length human PA2G4 protein.
gene name :
PA2G4
gene alias :
EBP1 HG4-1 p38-2G4
gene description :
proliferation-associated 2G4, 38kDa
genbank accession :
BC007561
immunogen :
PA2G4 (NP_006182.2, 1 a.a. ~ 394 a.a) full-length human protein.
immunogen sequence protein sequence :
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEAS
SSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPT
SISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGF
IANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRL
VKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVI
DGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGE
GKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRF
DAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKE
GEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQD
AELKALLQSSASRKTQKKKKKKASKTAENATSGETLEEN
EAGD
SSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPT
SISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGF
IANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRL
VKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVI
DGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGE
GKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRF
DAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKE
GEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQD
AELKALLQSSASRKTQKKKKKKASKTAENATSGETLEEN
EAGD
protein accession :
NP_006182.2
storage buffer :
No additive
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse
application key :
IF,WB-Tr,IP,WB-Ce,WB-Ti
size :
100 uL
autodate :
3/29/10
updatetime :
2/5/20 11:36
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
