This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ORC1L monoclonal antibody (M01), clone 3H1
catalog :
H00004998-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3H1
reactivity :
human
application :
immunohistochemistry - paraffin section
product information
catalog id :
H00004998-M01
product name :
ORC1L monoclonal antibody (M01), clone 3H1
product description :
Mouse monoclonal antibody raised against a partial recombinant ORC1L.
clone name :
3H1
isotype :
IgG2b Kappa
gene name :
ORC1L
gene alias :
HSORC1 ORC1 PARC1
gene description :
origin recognition complex, subunit 1-like (yeast)
genbank accession :
BC011539
immunogen :
ORC1L (AAH11539, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTE
GCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDP
PPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
GCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDP
PPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
protein accession :
AAH11539
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IHC-P,S-ELISA,ELISA
size :
100 ug
autodate :
2008-06-09
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
