This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NR4A2 monoclonal antibody (M08), clone 2G5
catalog :
H00004929-M08
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2G5
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00004929-M08
product name :
NR4A2 monoclonal antibody (M08), clone 2G5
product description :
Mouse monoclonal antibody raised against a partial recombinant NR4A2.
clone name :
2G5
isotype :
IgG2a Kappa
gene name :
NR4A2
gene alias :
HZF-3 NOT NURR1 RNR1 TINUR
gene description :
nuclear receptor subfamily 4, group A, member 2
genbank accession :
BC066890
immunogen :
NR4A2 (AAH66890, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSR
LSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHH
VVDGQTFAVPNPIRKPASMGFP
LSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHH
VVDGQTFAVPNPIRKPASMGFP
protein accession :
AAH66890
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,WB-Tr,ELISA,WB-Re,WB-Ce,IF,WB-Ti
size :
100 ug
autodate :
5/16/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
