This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ROR2 monoclonal antibody (M03), clone 2A10
catalog :
H00004920-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A10
reactivity :
human
product information
catalog id :
H00004920-M03
product name :
ROR2 monoclonal antibody (M03), clone 2A10
product description :
Mouse monoclonal antibody raised against a partial recombinant ROR2.
clone name :
2A10
isotype :
IgG2a Kappa
gene name :
ROR2
gene alias :
BDB BDB1 MGC163394 NTRKR2
gene description :
receptor tyrosine kinase-like orphan receptor 2
genbank accession :
NM_004560
immunogen :
ROR2 (NP_004551, 34 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNIT
IVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIII
RKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
IVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIII
RKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
protein accession :
NP_004551
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2007-01-12
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
