This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ROR1 monoclonal antibody (M01), clone 2F8
catalog :
H00004919-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human, mouse, rat
application :
western blot, ELISA
product information
catalog id :
H00004919-M01
product name :
ROR1 monoclonal antibody (M01), clone 2F8
product description :
Mouse monoclonal antibody raised against a partial recombinant ROR1.
clone name :
2F8
isotype :
IgG1 kappa
gene name :
ROR1
gene alias :
MGC99659 NTRKR1 dJ537F10.1
gene description :
receptor tyrosine kinase-like orphan receptor 1
genbank accession :
BC006374
immunogen :
ROR1 (-, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGR
QCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEA
PWCFTLDENFKSDLCDIPACGK
QCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEA
PWCFTLDENFKSDLCDIPACGK
protein accession :
-
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
ELISA,WB-Re
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
