This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NTRK2 monoclonal antibody (M01), clone 4D3-F10
catalog :
H00004915-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4D3-F10
reactivity :
human
application :
western blot, ELISA
citations: 2
| Reference |
|---|
Martens L, Kirschner K, Warnecke C, Scholz H. Hypoxia-inducible factor-1 (HIF-1) is a transcriptional activator of the TrkB neurotrophin receptor gene. J Biol Chem. 2007;282:14379-88 pubmed
|
product information
catalog id :
H00004915-M01
product name :
NTRK2 monoclonal antibody (M01), clone 4D3-F10
product description :
Mouse monoclonal antibody raised against a full length recombinant NTRK2.
clone name :
4D3-F10
isotype :
IgG2a Kappa
gene name :
NTRK2
gene alias :
GP145-TrkB TRKB
gene description :
neurotrophic tyrosine kinase, receptor, type 2
genbank accession :
BC031835
immunogen :
NTRK2 (AAH31835, 1 a.a. ~ 477 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCS
ASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKR
LEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNL
QHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDI
MWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCG
LPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGN
LVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVG
EDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPK
PALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNP
THMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANP
NYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGRE
HLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV
LFHKIPLDG
ASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKR
LEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNL
QHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDI
MWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCG
LPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGN
LVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVG
EDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPK
PALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNP
THMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANP
NYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGRE
HLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFV
LFHKIPLDG
protein accession :
AAH31835
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
1/18/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
