This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
NRAS (Human) Recombinant Protein (P01)
catalog :
H00004893-P01
quantity :
25 ug
product information
catalog id :
H00004893-P01
product name :
NRAS (Human) Recombinant Protein (P01)
product description :
Human NRAS full-length ORF ( NP_002515.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
gene name :
NRAS
gene alias :
ALPS4 N-ras NRAS1
gene description :
neuroblastoma RAS viral (v-ras) oncogene homolog
genbank accession :
NM_002524.2
immunogen sequence protein sequence :
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDS
YRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGF
LCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNK
CDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAF
YTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
YRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGF
LCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNK
CDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAF
YTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
protein accession :
NP_002515.1
preparation method :
in vitro wheat germ expression system
storage buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
note :
Best use within three months from the date of receipt of this protein.
tag :
GST
type clonality :
Protein
raised in host species :
Wheat Germ (in vitro)
antigen species target species :
Human
application key :
AP,Array,ELISA,WB-Re
size :
25 ug
autodate :
2008-07-24
updatetime :
2013-10-18 19:00:17
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
