This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NOVA1 monoclonal antibody (M10), clone 5D9
catalog :
H00004857-M10
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5D9
reactivity :
human, rat
application :
western blot, ELISA
product information
catalog id :
H00004857-M10
product name :
NOVA1 monoclonal antibody (M10), clone 5D9
product description :
Mouse monoclonal antibody raised against a partial recombinant NOVA1.
clone name :
5D9
isotype :
IgG1 Kappa
gene name :
NOVA1
gene alias :
Nova-1
gene description :
neuro-oncological ventral antigen 1
genbank accession :
NM_002515
immunogen :
NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVE
YQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQ
YLITQRITYEQGVRAANPQKVG
YQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQ
YLITQRITYEQGVRAANPQKVG
protein accession :
NP_002506
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
WB-Ce,ELISA,WB-Re
size :
100 ug
autodate :
2008-05-02
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
