This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NODAL monoclonal antibody (M03J), clone 5C3
catalog :
H00004838-M03J
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
product information
catalog id :
H00004838-M03J
product name :
NODAL monoclonal antibody (M03J), clone 5C3
product description :
Mouse monoclonal antibody raised against a partial recombinant NODAL.
clone name :
5C3
isotype :
IgG1 Kappa
gene name :
NODAL
gene alias :
MGC138230
gene description :
nodal homolog (mouse)
genbank accession :
NM_018055
immunogen :
NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCC
APVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
APVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
protein accession :
NP_060525
preparation method :
Cell Culture Production. (CX Grade Antibody List)
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
IHC-P,IF,WB-Ce,S-ELISA,WB-Re,ELISA
size :
100 ug
autodate :
5/28/19
updatetime :
12/12/19 14:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
