This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NFE2L2 monoclonal antibody (M04), clone 3G7
catalog :
H00004780-M04
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3G7
reactivity :
human, mouse, rat
application :
western blot, ELISA
product information
catalog id :
H00004780-M04
product name :
NFE2L2 monoclonal antibody (M04), clone 3G7
product description :
Mouse monoclonal antibody raised against a full length recombinant NFE2L2.
clone name :
3G7
isotype :
IgG2a Kappa
gene name :
NFE2L2
gene alias :
NRF2
gene description :
nuclear factor (erythroid-derived 2)-like 2
genbank accession :
NM_006164
immunogen :
NFE2L2 (NP_006155.2, 351 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVK
QNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEK
ELPVSPGHRKTPFTKDKHSSRL
QNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEK
ELPVSPGHRKTPFTKDKHSSRL
protein accession :
NP_006155.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Ce,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
5/25/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
