This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MYH9 monoclonal antibody (M01A), clone 3C7
catalog :
H00004627-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C7
reactivity :
human, mouse
application :
western blot, ELISA
product information
catalog id :
H00004627-M01A
product name :
MYH9 monoclonal antibody (M01A), clone 3C7
product description :
Mouse monoclonal antibody raised against a partial recombinant MYH9.
clone name :
3C7
isotype :
IgG2b Kappa
gene name :
MYH9
gene alias :
DFNA17 EPSTS FTNS MGC104539 MHA NMHC-II-A NMMHCA
gene description :
myosin, heavy chain 9, non-muscle
genbank accession :
NM_002473.5
immunogen :
MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADA
MNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVD
GKADGAEAKPAE
MNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVD
GKADGAEAKPAE
protein accession :
NP_002464.1
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse
application key :
WB-Ce,ELISA,WB-Re
size :
200 uL
autodate :
2007-03-01
updatetime :
2017-04-28 11:23:56
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
