product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
MUC5AC monoclonal antibody (M07), clone 2H7
catalog :
H00004586-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2H7
reactivity :
human
application :
western blot, ELISA
more info or order :
citations: 1
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| Lachowicz Scroggins M, Yuan S, Kerr S, Dunican E, Yu M, Carrington S, et al. Abnormalities in MUC5AC and MUC5B Protein in Airway Mucus in Asthma. Am J Respir Crit Care Med. 2016;194:1296-1299 pubmed
|
product information
catalog id :
H00004586-M07
product name :
MUC5AC monoclonal antibody (M07), clone 2H7
product description :
Mouse monoclonal antibody raised against a partial recombinant MUC5AC.
clone name :
2H7
isotype :
IgG1 Kappa
gene name :
MUC5AC
gene alias :
MUC5
gene description :
mucin 5AC, oligomeric mucus/gel-forming
genbank accession :
XM_495860
immunogen :
MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSS
MYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFS
YTEVEECGCMGRRCPAPGDTQH
MYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFS
YTEVEECGCMGRRCPAPGDTQH
protein accession :
XP_495860
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-11-03
updatetime :
2013-11-15 18:37:01
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
questions and comments
