This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MPZ polyclonal antibody (A01)
catalog :
H00004359-A01
quantity :
50 uL
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00004359-A01
product name :
MPZ polyclonal antibody (A01)
product description :
Mouse polyclonal antibody raised against a full-length recombinant MPZ.
gene name :
MPZ
gene alias :
CHM CMT1 CMT1B CMT2I CMT2J CMT4E CMTDI3 DSS HMSNIB MPP P0
gene description :
myelin protein zero
genbank accession :
BC006491
immunogen :
MPZ (AAH06491.1, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag.
immunogen sequence protein sequence :
MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQA
IVVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRY
QPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRW
KDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYV
FEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLR
RQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLD
HSRSTKAVSEKKAKGLGESRKDKK
IVVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRY
QPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRW
KDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYV
FEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLR
RQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLD
HSRSTKAVSEKKAKGLGESRKDKK
protein accession :
AAH06491.1
storage buffer :
50 % glycerol
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
50 uL
autodate :
10/11/06
updatetime :
2/16/12 10:06
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
