This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MIF monoclonal antibody (M01J), clone 2A10-4D3
catalog :
H00004282-M01J
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A10-4D3
reactivity :
human
application :
western blot, ELISA, immunoprecipitation, immunohistochemistry - paraffin section
product information
catalog id :
H00004282-M01J
product name :
MIF monoclonal antibody (M01J), clone 2A10-4D3
product description :
Mouse monoclonal antibody raised against a full-length recombinant MIF.
clone name :
2A10-4D3
isotype :
IgG1 Kappa
gene name :
MIF
gene alias :
GIF GLIF MMIF
gene description :
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
genbank accession :
BC000447
immunogen :
MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIA
VHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSK
LLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
VHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSK
LLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
protein accession :
AAH00447.1
preparation method :
Cell Culture Production. (CX Grade Antibody List)
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,S-ELISA,IP,IHC-P,WB-Re,ELISA
size :
100 ug
autodate :
1/15/19
updatetime :
12/12/19 14:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
