This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
KITLG monoclonal antibody (M06), clone 4H7
catalog :
H00004254-M06
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4H7
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00004254-M06
product name :
KITLG monoclonal antibody (M06), clone 4H7
product description :
Mouse monoclonal antibody raised against a partial recombinant KITLG.
clone name :
4H7
isotype :
IgG2a Kappa
gene name :
KITLG
gene alias :
DKFZp686F2250 KL-1 Kitl MGF SCF SF SHEP7
gene description :
KIT ligand
genbank accession :
NM_003994
immunogen :
KITLG (NP_003985, 26 a.a. ~ 245 a.a) partial recombinant protein.
immunogen sequence protein sequence :
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVL
PSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDK
LVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFR
IFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPPG
DSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAV
ENIQINEEDNEISMLQEKEREFQEV
PSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDK
LVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFR
IFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPPG
DSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAV
ENIQINEEDNEISMLQEKEREFQEV
protein accession :
NP_003985
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA
size :
100 ug
autodate :
2007-07-25
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
