This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CD46 monoclonal antibody (M07), clone 2E10
catalog :
H00004179-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2.00E+10
reactivity :
human
product information
catalog id :
H00004179-M07
product name :
CD46 monoclonal antibody (M07), clone 2E10
product description :
Mouse monoclonal antibody raised against a partial recombinant MCP.
clone name :
2.00E+10
isotype :
IgG2a Kappa
gene name :
CD46
gene alias :
MCP MGC26544 MIC10 TLX TRA2.10
gene description :
CD46 molecule, complement regulatory protein
genbank accession :
BC030594
immunogen :
CD46 (AAH30594, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPL
ATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPA
NGTYEFGYQMHFICNEGYYLIG
ATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPA
NGTYEFGYQMHFICNEGYYLIG
protein accession :
AAH30594
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
11/20/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
