This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MAX monoclonal antibody (M01), clone 4E10-1A9
catalog :
H00004149-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4E10-1A9
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00004149-M01
product name :
MAX monoclonal antibody (M01), clone 4E10-1A9
product description :
Mouse monoclonal antibody raised against a full length recombinant MAX.
clone name :
4E10-1A9
isotype :
IgG2a kappa
gene name :
MAX
gene alias :
MGC10775 MGC11225 MGC18164 MGC34679 MGC36767 bHLHd4 bHLHd5 bHLHd6 bHLHd7 bHLHd8 orf1
gene description :
MYC associated factor X
genbank accession :
BC003525
immunogen :
MAX (AAH03525, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRD
SVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDD
LKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNA
KGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
SVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDD
LKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNA
KGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
protein accession :
AAH03525
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re,PLA-Ce
size :
100 ug
autodate :
2007-12-04
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
