This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SMAD4 monoclonal antibody (M01A), clone 3B9
catalog :
H00004089-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B9
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00004089-M01A
product name :
SMAD4 monoclonal antibody (M01A), clone 3B9
product description :
Mouse monoclonal antibody raised against a full-length recombinant SMAD4.
clone name :
3B9
isotype :
IgG2a Kappa
gene name :
SMAD4
gene alias :
DPC4 JIP MADH4
gene description :
SMAD family member 4
genbank accession :
BC002379
immunogen :
SMAD4 (AAH02379, 1 a.a. ~ 552 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRA
IESLVKKLKEKKDELDSLITAITTSGAHPSKCVTIQRTL
DGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQY
AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSM
MVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETY
STPALLAPSESNATSTANFPNIPVASTSQPASILGGSHS
EGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRT
APYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQP
PISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVD
GYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLE
CKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKI
YPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGN
IPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVK
GWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIA
DPQPLD
IESLVKKLKEKKDELDSLITAITTSGAHPSKCVTIQRTL
DGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQY
AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSM
MVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETY
STPALLAPSESNATSTANFPNIPVASTSQPASILGGSHS
EGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRT
APYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQP
PISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVD
GYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLE
CKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKI
YPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGN
IPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVK
GWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIA
DPQPLD
protein accession :
AAH02379
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
200 uL
autodate :
2008-12-01
updatetime :
2012-01-13 16:42:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
