This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SMAD3 monoclonal antibody (M07), clone 1B7
catalog :
H00004088-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B7
reactivity :
human, mouse, rat
application :
western blot, ELISA
product information
catalog id :
H00004088-M07
product name :
SMAD3 monoclonal antibody (M07), clone 1B7
product description :
Mouse monoclonal antibody raised against a partial recombinant SMAD3.
clone name :
1B7
isotype :
IgG2b Kappa
gene name :
SMAD3
gene alias :
DKFZp586N0721 DKFZp686J10186 HSPC193 HsT17436 JV15-2 MADH3 MGC60396
gene description :
SMAD family member 3
genbank accession :
NM_005902
immunogen :
SMAD3 (NP_005893, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLV
KKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVS
HRKGLPHVIYCRLWRWPDLHSHHELRAMELCE
KKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVS
HRKGLPHVIYCRLWRWPDLHSHHELRAMELCE
protein accession :
NP_005893
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Ce,S-ELISA,ELISA,WB-Tr
size :
100 ug
autodate :
2008-04-18
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
