This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SH2D1A monoclonal antibody (M01), clone 1C9
catalog :
H00004068-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C9
reactivity :
human
application :
western blot, ELISA
citations: 3
| Reference |
|---|
product information
catalog id :
H00004068-M01
product name :
SH2D1A monoclonal antibody (M01), clone 1C9
product description :
Mouse monoclonal antibody raised against a full length recombinant SH2D1A.
clone name :
1C9
isotype :
IgG2a Kappa
gene name :
SH2D1A
gene alias :
DSHP EBVS FLJ18687 FLJ92177 IMD5 LYP MTCP1 SAP XLP XLPD
gene description :
SH2 domain protein 1A
genbank accession :
BC020732
immunogen :
SH2D1A (AAH20732, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPG
VYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFR
KIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGI
REDPDVCLKAP
VYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFR
KIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGI
REDPDVCLKAP
protein accession :
AAH20732
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,WB-Tr,ELISA,WB-Re,WB-Ce
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
