This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
LTA monoclonal antibody (M12), clone 1A12
catalog :
H00004049-M12
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1A12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00004049-M12
product name :
LTA monoclonal antibody (M12), clone 1A12
product description :
Mouse monoclonal antibody raised against a partial recombinant LTA.
clone name :
1A12
isotype :
IgG1, kappa
gene name :
LTA
gene alias :
LT TNFB TNFSF1
gene description :
lymphotoxin alpha (TNF superfamily, member 1)
genbank accession :
BC034729.1
immunogen :
Recombinant Flag/His fusion protein corresponding to amino acids 58-205 of human LTA.
immunogen sequence protein sequence :
HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSN
NSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEV
QLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQ
LTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
NSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEV
QLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQ
LTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
protein accession :
AAH34729.1
form :
Liquid
recommend dilutions :
The optimal working dilution should be determined by the end user
storage buffer :
In PBS, pH 7.2
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
conjugate tag :
Flag/His
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2008-07-31
updatetime :
2015-08-10 15:56:33
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
