This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
LFNG monoclonal antibody (M05), clone 3C4
catalog :
H00003955-M05
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C4
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00003955-M05
product name :
LFNG monoclonal antibody (M05), clone 3C4
product description :
Mouse monoclonal antibody raised against a full length recombinant LFNG.
clone name :
3C4
isotype :
IgG2b Kappa
gene name :
LFNG
gene alias :
SCDO3
gene description :
LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
genbank accession :
BC014851
immunogen :
LFNG (AAH14851, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNC
SAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNL
RALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVR
PVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERI
RLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTS
ELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIH
CHLYPDTPWCPRTAIF
SAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNL
RALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVR
PVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERI
RLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTS
ELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIH
CHLYPDTPWCPRTAIF
protein accession :
AAH14851
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Tr
size :
50 ug
autodate :
9/3/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
