This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
KLRB1 monoclonal antibody (M01J), clone 2F3
catalog :
H00003820-M01J
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F3
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00003820-M01J
product name :
KLRB1 monoclonal antibody (M01J), clone 2F3
product description :
Mouse monoclonal antibody raised against a full length recombinant KLRB1.
clone name :
2F3
isotype :
IgG1 Kappa
gene name :
KLRB1
gene alias :
CD161 CLEC5B MGC138614 NKR NKR-P1 NKR-P1A NKRP1A hNKR-P1A
gene description :
killer cell lectin-like receptor subfamily B, member 1
genbank accession :
NM_002258
immunogen :
KLRB1 (NP_002249, 126 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKN
WKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCS
TEIRWICQKELTPVRNKVYPDS
WKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCS
TEIRWICQKELTPVRNKVYPDS
protein accession :
NP_002249
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
50 ug
autodate :
2008-08-28
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
