This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ITPA monoclonal antibody (M01), clone 2H8
catalog :
H00003704-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2H8
reactivity :
human
citations: 1
product information
catalog id :
H00003704-M01
product name :
ITPA monoclonal antibody (M01), clone 2H8
product description :
Mouse monoclonal antibody raised against a partial recombinant ITPA.
clone name :
2H8
isotype :
IgG2a Kappa
gene name :
ITPA
gene alias :
C20orf37 HLC14-06-P ITPase dJ794I6.3
gene description :
inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
genbank accession :
NM_033453
immunogen :
ITPA (NP_258412.1, 89 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQ
PVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAE
MPKAEKNAVSHRFRALLELQEYFGSLA
PVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAE
MPKAEKNAVSHRFRALLELQEYFGSLA
protein accession :
NP_258412.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2008-09-10
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
