This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IL15 monoclonal antibody (M10), clone 3E8
catalog :
H00003600-M10
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3E8
reactivity :
human
product information
catalog id :
H00003600-M10
product name :
IL15 monoclonal antibody (M10), clone 3E8
product description :
Mouse monoclonal antibody raised against a full length recombinant IL15.
clone name :
3E8
isotype :
IgG2a Kappa
gene name :
IL15
gene alias :
IL-15 MGC9721
gene description :
interleukin 15
genbank accession :
NM_000585
immunogen :
IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.
immunogen sequence protein sequence :
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTA
MKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNG
NVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
MKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNG
NVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
protein accession :
NP_000576
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
2006-12-10
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
