This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IL9 monoclonal antibody (M01), clone 1C9
catalog :
H00003578-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C9
reactivity :
human
product information
catalog id :
H00003578-M01
product name :
IL9 monoclonal antibody (M01), clone 1C9
product description :
Mouse monoclonal antibody raised against a full-length recombinant IL9.
clone name :
1C9
isotype :
IgG1 Kappa
gene name :
IL9
gene alias :
HP40 IL-9 P40
gene description :
interleukin 9
genbank accession :
NM_000590.1
immunogen :
IL9 (NP_000581.1, 18 a.a. ~ 144 a.a) full-length recombinant protein.
immunogen sequence protein sequence :
MQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLC
LGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKS
VEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQK
EKMRGMRGKI
LGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKS
VEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQK
EKMRGMRGKI
protein accession :
NP_000581.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
2014-01-16
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
