This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IL8 monoclonal antibody (M21), clone 4F1
catalog :
H00003576-M21
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4F1
reactivity :
human
application :
western blot, ELISA, immunoprecipitation
product information
catalog id :
H00003576-M21
product name :
IL8 monoclonal antibody (M21), clone 4F1
product description :
Mouse monoclonal antibody raised against a full length recombinant IL8.
clone name :
4F1
isotype :
IgG2a Kappa
gene name :
IL8
gene alias :
CXCL8 GCP-1 GCP1 LECT LUCT LYNAP MDNCF MONAP NAF NAP-1 NAP1
gene description :
interleukin 8
genbank accession :
BC013615
immunogen :
IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.
immunogen sequence protein sequence :
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGP
HCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAEN
S
HCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAEN
S
protein accession :
AAH13615
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IP,ELISA,WB-Re
size :
100 ug
autodate :
6/29/07
updatetime :
9/5/17 15:48
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
