This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IL1A monoclonal antibody (M02), clone 1F3
catalog :
H00003552-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F3
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00003552-M02
product name :
IL1A monoclonal antibody (M02), clone 1F3
product description :
Mouse monoclonal antibody raised against a partial recombinant IL1A.
clone name :
1F3
isotype :
IgG1 Kappa
gene name :
IL1A
gene alias :
IL-1A IL1 IL1-ALPHA IL1F1
gene description :
interleukin 1, alpha
genbank accession :
BC013142
immunogen :
IL1A (AAH13142, 172 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEI
PKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQD
YWVCLAGGPPSITDFQILENQA
PKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQD
YWVCLAGGPPSITDFQILENQA
protein accession :
AAH13142
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2009-07-06
updatetime :
2013-11-15 18:43:32
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
