CYR61 (Human) Recombinant Protein (P01) | Abnova H00003491-P01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Abnova

product type :

protein

product name :

CYR61 (Human) Recombinant Protein (P01)

catalog :

H00003491-P01

quantity :

2 ug

citations: 12

Reference
Wu P, Lin S, Lee B, Kok S, Wang J, Hou K, et al. Epigallocatechin-3-gallate diminishes cytokine-stimulated Cyr61 expression in human osteoblastic cells: a therapeutic potential for arthritis. Rheumatology (Oxford). 2012;51:1953-65 pubmed publisher
Terada N, Shiraishi T, Zeng Y, Mooney S, Yeater D, Mangold L, et al. Cyr61 is regulated by cAMP-dependent protein kinase with serum levels correlating with prostate cancer aggressiveness. Prostate. 2012;72:966-76 pubmed publisher
You J, Yang C, Chen M, Yang C. Regulation of Cyr61/CCN1 expression by hypoxia through cooperation of c-Jun/AP-1 and HIF-1? in retinal vascular endothelial cells. Exp Eye Res. 2010;91:825-36 pubmed publisher
Su J, Chiou J, Tang C, Zhao M, Tsai C, Chen P, et al. CYR61 regulates BMP-2-dependent osteoblast differentiation through the {alpha}v{beta}3 integrin/integrin-linked kinase/ERK pathway. J Biol Chem. 2010;285:31325-36 pubmed publisher
Chai J, Norng M, Modak C, Reavis K, Mouazzen W, Pham J. CCN1 induces a reversible epithelial-mesenchymal transition in gastric epithelial cells. Lab Invest. 2010;90:1140-51 pubmed publisher
Kok S, Hou K, Hong C, Wang J, Liang P, Chang C, et al. Simvastatin inhibits cytokine-stimulated Cyr61 expression in osteoblastic cells: a therapeutic benefit for arthritis. Arthritis Rheum. 2011;63:1010-20 pubmed publisher
Bär A, Dorfman S, Fischer P, Hilfiker Kleiner D, Cebotari S, Tudorache I, et al. The pro-angiogenic factor CCN1 enhances the re-endothelialization of biological vascularized matrices in vitro. Cardiovasc Res. 2010;85:806-13 pubmed publisher
You J, Yang C, Chen M, Yang C. Cysteine-rich 61, a member of the CCN family, as a factor involved in the pathogenesis of proliferative diabetic retinopathy. Invest Ophthalmol Vis Sci. 2009;50:3447-55 pubmed publisher
Lin B, Chang C, Chen L, Wu M, Wang M, Kuo I, et al. Cysteine-rich 61 (CCN1) enhances chemotactic migration, transendothelial cell migration, and intravasation by concomitantly up-regulating chemokine receptor 1 and 2. Mol Cancer Res. 2007;5:1111-23 pubmed
Athanasopoulos A, Schneider D, Keiper T, Alt V, Pendurthi U, Liegibel U, et al. Vascular endothelial growth factor (VEGF)-induced up-regulation of CCN1 in osteoblasts mediates proangiogenic activities in endothelial cells and promotes fracture healing. J Biol Chem. 2007;282:26746-53 pubmed
Grote K, Salguero G, Ballmaier M, Dangers M, Drexler H, Schieffer B. The angiogenic factor CCN1 promotes adhesion and migration of circulating CD34+ progenitor cells: potential role in angiogenesis and endothelial regeneration. Blood. 2007;110:877-85 pubmed
O Connor R, Mills S, Jones K, Ho S, Pavlath G. A combinatorial role for NFAT5 in both myoblast migration and differentiation during skeletal muscle myogenesis. J Cell Sci. 2007;120:149-59 pubmed

product information

catalog id :

H00003491-P01

product name :

CYR61 (Human) Recombinant Protein (P01)

product description :

Human CYR61 full-length ORF ( AAH01271.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.

gene name :

CYR61

gene alias :

CCN1 GIG1 IGFBP10

gene description :

cysteine-rich, angiogenic inducer, 61

genbank accession :

BC001271

immunogen sequence protein sequence :

MSSRIARALALVVTLLHLTRLAPSTCPAACHCPLEAPKC
APGVGLVRDGCGCCKVCAKQLNEDCSKTQPCDHTKGLEC
NFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNC
KHQCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQ
CCEEWVCDEDSIKDPMEDQDGLLGKELGFDASEVELTRN
NELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTT
SWSQCSKTCGTGISTRVTNDNPECRLVKETRICKVRPCG
QPVYSSLKKGKKCSKTKKSPEPVRFTYAGCLSVKKYRPK
YCGSCVDGRCCTPQLTRTVKMRFRCEDGETFSKNVMMIQ
SCKCNYNCPHANEAAFPFYRLFNDIHKFRD

protein accession :

AAH01271.1

preparation method :

in vitro wheat germ expression system

storage buffer :

50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

storage instruction :

Store at -80 C. Aliquot to avoid repeated freezing and thawing.

quality control testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

note :

Best use within three months from the date of receipt of this protein.

tag :

GST

type clonality :

Protein

raised in host species :

Wheat Germ (in vitro)

antigen species target species :

Human

application key :

AP,Array,ELISA,WB-Re

size :

2 ug

autodate :

2008-07-21

updatetime :

2013-10-18 19:00:17