This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
IGF1 polyclonal antibody (A01)
catalog :
H00003479-A01
quantity :
50 uL
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00003479-A01
product name :
IGF1 polyclonal antibody (A01)
product description :
Mouse polyclonal antibody raised against a partial recombinant IGF1.
gene name :
IGF1
gene alias :
IGFI
gene description :
insulin-like growth factor 1 (somatomedin C)
genbank accession :
NM_000618
immunogen :
IGF1 (NP_000609, 49 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
immunogen sequence protein sequence :
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAP
QTGIVDECCFRSRDLRRLEMYCAPLKPTKSARSVRAQRH
TDMPKTQKEVHL
QTGIVDECCFRSRDLRRLEMYCAPLKPTKSARSVRAQRH
TDMPKTQKEVHL
protein accession :
NP_000609
storage buffer :
50 % glycerol
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
50 uL
autodate :
10/11/06
updatetime :
2/16/12 10:09
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
