This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FOXA2 monoclonal antibody (M02), clone 2F12
catalog :
H00003170-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F12
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
catalog id :
H00003170-M02
product name :
FOXA2 monoclonal antibody (M02), clone 2F12
product description :
Mouse monoclonal antibody raised against a partial recombinant FOXA2.
clone name :
2F12
isotype :
IgG2a Kappa
gene name :
FOXA2
gene alias :
HNF3B MGC19807 TCF3B
gene description :
forkhead box A2
genbank accession :
NM_021784
immunogen :
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMD
LKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAA
DTSYYQGVYSRPIMNSS
LKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAA
DTSYYQGVYSRPIMNSS
protein accession :
NP_068556
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,IHC-P,WB-Ce
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
