This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FOXA1 monoclonal antibody (M05), clone 3C1
catalog :
H00003169-M05
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C1
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
product information
catalog id :
H00003169-M05
product name :
FOXA1 monoclonal antibody (M05), clone 3C1
product description :
Mouse monoclonal antibody raised against a partial recombinant FOXA1.
clone name :
3C1
isotype :
IgG1 Kappa
gene name :
FOXA1
gene alias :
HNF3A MGC33105 TCF3A
gene description :
forkhead box A1
genbank accession :
NM_004496
immunogen :
FOXA1 (NP_004487, 367 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNL
MSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV
TTRSPIEPSALEPAYYQGVYSRPVLNTS
MSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV
TTRSPIEPSALEPAYYQGVYSRPVLNTS
protein accession :
NP_004487
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re,WB-Ce,IF,IHC-P
size :
100 ug
autodate :
1/12/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
