This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
HMX2 monoclonal antibody (M07A), clone 1B10
catalog :
H00003167-M07A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00003167-M07A
product name :
HMX2 monoclonal antibody (M07A), clone 1B10
product description :
Mouse monoclonal antibody raised against a partial recombinant HMX2.
clone name :
1B10
isotype :
IgG2a
gene name :
HMX2
gene alias :
H6L Nkx5-2
gene description :
H6 family homeobox 2
genbank accession :
NM_005519
immunogen :
HMX2 (NP_005510, 125 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQ
LESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRN
KWKRQLSAELEAANMAHASAQT
LESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRN
KWKRQLSAELEAANMAHASAQT
protein accession :
NP_005510
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2009-03-09
updatetime :
2012-01-05 19:00:38
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
