This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
HMOX1 polyclonal antibody (A02)
catalog :
H00003162-A02
quantity :
50 uL
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00003162-A02
product name :
HMOX1 polyclonal antibody (A02)
product description :
Mouse polyclonal antibody raised against a partial recombinant HMOX1.
gene name :
HMOX1
gene alias :
HO-1 HSP32 bK286B10
gene description :
heme oxygenase (decycling) 1
genbank accession :
NM_002133
immunogen :
HMOX1 (ENSP00000216117, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
immunogen sequence protein sequence :
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQK
GQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVY
FPEELHRKAALEQDLAFWYGPRWQEVIPYTPA
GQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVY
FPEELHRKAALEQDLAFWYGPRWQEVIPYTPA
protein accession :
ENSP00000216117
storage buffer :
50 % glycerol
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
50 uL
autodate :
2006-10-11
updatetime :
2012-02-16 10:06:19
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
