HMGB1 (Human) Recombinant Protein (P01) | Abnova H00003146-P01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Abnova

product type :

protein

product name :

HMGB1 (Human) Recombinant Protein (P01)

catalog :

H00003146-P01

quantity :

10 ug,25 ug

citations: 12

Reference
Lee W, Ku S, Bae J. Barrier protective effects of rutin in LPS-induced inflammation in vitro and in vivo. Food Chem Toxicol. 2012;50:3048-55 pubmed publisher
Lee W, Kim T, Ku S, Min K, Lee H, Kwon T, et al. Barrier protective effects of withaferin A in HMGB1-induced inflammatory responses in both cellular and animal models. Toxicol Appl Pharmacol. 2012;262:91-8 pubmed publisher
Kim T, Ku S, Lee T, Bae J. Vascular barrier protective effects of phlorotannins on HMGB1-mediated proinflammatory responses in vitro and in vivo. Food Chem Toxicol. 2012;50:2188-95 pubmed publisher
Lee W, Ku S, Bae J, Bae J. Inhibitory effects of lycopene on HMGB1-mediated pro-inflammatory responses in both cellular and animal models. Food Chem Toxicol. 2012;50:1826-33 pubmed publisher
Yang E, Lee W, Ku S, Song K, Bae J. Anti-inflammatory activities of oleanolic acid on HMGB1 activated HUVECs. Food Chem Toxicol. 2012;50:1288-94 pubmed publisher
Kim T, Ku S, Bae J. Inhibitory effects of kaempferol-3-O-sophoroside on HMGB1-mediated proinflammatory responses. Food Chem Toxicol. 2012;50:1118-23 pubmed publisher
Bae J. Effects of lower concentration thrombin on high-mobility group box 1 protein-mediated inflammatory responses. Inflammation. 2012;35:1078-86 pubmed publisher
Kim D, Lee W, Bae J. Vascular anti-inflammatory effects of curcumin on HMGB1-mediated responses in vitro. Inflamm Res. 2011;60:1161-8 pubmed publisher
Bae J, Rezaie A. Activated protein C inhibits high mobility group box 1 signaling in endothelial cells. Blood. 2011;118:3952-9 pubmed publisher
Bounaix Morand du Puch C, Barbier E, Kraut A, Coute Y, Fuchs J, Buhot A, et al. TOX4 and its binding partners recognize DNA adducts generated by platinum anticancer drugs. Arch Biochem Biophys. 2011;507:296-303 pubmed publisher
Sasahira T, Kirita T, Bhawal U, Ikeda M, Nagasawa A, Yamamoto K, et al. The expression of receptor for advanced glycation end products is associated with angiogenesis in human oral squamous cell carcinoma. Virchows Arch. 2007;450:287-95 pubmed
Kuniyasu H, Yano S, Sasaki T, Sasahira T, Sone S, Ohmori H. Colon cancer cell-derived high mobility group 1/amphoterin induces growth inhibition and apoptosis in macrophages. Am J Pathol. 2005;166:751-60 pubmed

product information

catalog id :

H00003146-P01

product name :

HMGB1 (Human) Recombinant Protein (P01)

product description :

Human HMGB1 full-length ORF ( AAH03378.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

gene name :

HMGB1

gene alias :

DKFZp686A04236 HMG1 HMG3 SBP-1

gene description :

high-mobility group box 1

genbank accession :

BC003378

immunogen sequence protein sequence :

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFS
EFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY
IPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEH
PGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYE
KDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEE
DEEEEEDEEDEDEEEDDDDE

protein accession :

AAH03378.1

preparation method :

in vitro wheat germ expression system

storage buffer :

50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

storage instruction :

Store at -80 C. Aliquot to avoid repeated freezing and thawing.

quality control testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

note :

Best use within three months from the date of receipt of this protein.

tag :

GST

type clonality :

Protein

raised in host species :

Wheat Germ (in vitro)

antigen species target species :

Human

application key :

AP,WB-Re,ELISA,Array

size :

10 ug,25 ug

autodate :

10/6/08

updatetime :

10/18/13 19:02