This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
HLA-DRA MaxPab rabbit polyclonal antibody (D01)
catalog :
H00003122-D01
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunoprecipitation
product information
catalog id :
H00003122-D01
product name :
HLA-DRA MaxPab rabbit polyclonal antibody (D01)
product description :
Rabbit polyclonal antibody raised against a full-length human HLA-DRA protein.
gene name :
HLA-DRA
gene alias :
HLA-DRA1
gene description :
major histocompatibility complex, class II, DR alpha
genbank accession :
NM_019111
immunogen :
HLA-DRA (NP_061984.2, 1 a.a. ~ 254 a.a) full-length human protein.
immunogen sequence protein sequence :
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYL
NPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFAS
FEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVL
TNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTG
VSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGL
DEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIG
TIFIIKGLRKSNAAERRGPL
NPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFAS
FEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVL
TNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTG
VSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGL
DEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIG
TIFIIKGLRKSNAAERRGPL
protein accession :
NP_061984.2
storage buffer :
No additive
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,WB-Tr,IP
size :
100 uL
autodate :
2010-03-15
updatetime :
2010-04-16 01:01:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
