This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
HLA-DMB monoclonal antibody (M07), clone 7D11
catalog :
H00003109-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
7D11
reactivity :
human
application :
western blot, ELISA, immunoprecipitation
product information
catalog id :
H00003109-M07
product name :
HLA-DMB monoclonal antibody (M07), clone 7D11
product description :
Mouse monoclonal antibody raised against a partial recombinant HLA-DMB.
clone name :
7D11
isotype :
IgG2b Kappa
gene name :
HLA-DMB
gene alias :
D6S221E RING7
gene description :
major histocompatibility complex, class II, DM beta
genbank accession :
NM_002118
immunogen :
HLA-DMB (NP_002109, 22 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCAT
HTQPFWGSLTNRTRPPSVQVAKTTPFNTRE
MAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCAT
HTQPFWGSLTNRTRPPSVQVAKTTPFNTRE
protein accession :
NP_002109
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re,WB-Tr,IP
size :
100 ug
autodate :
2008-06-02
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
