This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
HLA-C (Human) Recombinant Protein (P02)
catalog :
H00003107-P02
quantity :
10 ug,25 ug
product information
catalog id :
H00003107-P02
product name :
HLA-C (Human) Recombinant Protein (P02)
product description :
Human HLA-C full-length ORF (AAH02463.1, 1 a.a. - 366 a.a.) recombinant protein with GST tag at N-terminal.
gene name :
HLA-C
gene alias :
D6S204 FLJ27082 HLA-Cw HLA-Cw12 HLA-JY3 HLC-C PSORS1
gene description :
major histocompatibility complex, class I, C
genbank accession :
BC002463.1
immunogen sequence protein sequence :
MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRP
GRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQ
EGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSH
TLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRS
WTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRY
LENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYP
AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVV
PSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIV
AGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAASS
NSAQGSDESLIACKA
GRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQ
EGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSH
TLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRS
WTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRY
LENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYP
AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVV
PSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIV
AGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAASS
NSAQGSDESLIACKA
protein accession :
AAH02463.1
preparation method :
in vitro wheat germ expression system
storage buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
12.5% SDS-PAGE Stained with Coomassie Blue
note :
Best use within three months from the date of receipt of this protein.
tag :
GST
type clonality :
Protein
raised in host species :
Wheat Germ (in vitro)
antigen species target species :
Human
application key :
WB-Re,ELISA,Array,AP
size :
10 ug,25 ug
autodate :
4/28/15
updatetime :
8/20/19 14:15
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
