This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
GZMB monoclonal antibody (M01), clone 4F5
catalog :
H00003002-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4F5
reactivity :
human
application :
western blot, ELISA, immunoprecipitation
product information
catalog id :
H00003002-M01
product name :
GZMB monoclonal antibody (M01), clone 4F5
product description :
Mouse monoclonal antibody raised against a partial recombinant GZMB.
clone name :
4F5
isotype :
IgG2a Kappa
gene name :
GZMB
gene alias :
CCPI CGL-1 CGL1 CSP-B CSPB CTLA1 CTSGL1 HLP SECT
gene description :
granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
genbank accession :
BC030195
immunogen :
GZMB (AAH30195, 148 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIE
LCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGM
PPRACTKVSSFVHWIKKTMKRH
LCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGM
PPRACTKVSSFVHWIKKTMKRH
protein accession :
AAH30195
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,IP
size :
100 ug
autodate :
2009-06-22
updatetime :
2013-11-15 18:43:32
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
