This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
GSTM5 monoclonal antibody (M01), clone 1B3
catalog :
H00002949-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
product information
catalog id :
H00002949-M01
product name :
GSTM5 monoclonal antibody (M01), clone 1B3
product description :
Mouse monoclonal antibody raised against a partial recombinant GSTM5.
clone name :
1B3
isotype :
IgG2a Kappa
gene name :
GSTM5
gene alias :
GSTM5-5 GTM5
gene description :
glutathione S-transferase mu 5
genbank accession :
NM_000851
immunogen :
GSTM5 (NP_000842, 145 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
RPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKD
FISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
FISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
protein accession :
NP_000842
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2007-09-06
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
