This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
GRK4 monoclonal antibody (M01A), clone 6D12
catalog :
H00002868-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6D12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00002868-M01A
product name :
GRK4 monoclonal antibody (M01A), clone 6D12
product description :
Mouse monoclonal antibody raised against a partial recombinant GRK4.
clone name :
6D12
isotype :
IgG2b Kappa
gene name :
GRK4
gene alias :
GPRK2L GPRK4 GRK4a IT11
gene description :
G protein-coupled receptor kinase 4
genbank accession :
NM_182982
immunogen :
GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTK
PTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDK
LAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
PTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDK
LAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
protein accession :
NP_892027
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2008-09-04
updatetime :
2012-01-05 19:00:38
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
