This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SFN monoclonal antibody (M01), clone 3C3
catalog :
H00002810-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C3
reactivity :
human
application :
western blot, ELISA, immunoprecipitation, immunohistochemistry - paraffin section
product information
catalog id :
H00002810-M01
product name :
SFN monoclonal antibody (M01), clone 3C3
product description :
Mouse monoclonal antibody raised against a full length recombinant SFN.
clone name :
3C3
isotype :
IgG1 kappa
gene name :
SFN
gene alias :
YWHAS
gene description :
stratifin
genbank accession :
BC000329
immunogen :
SFN (AAH00329.1, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCE
ERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKG
PEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESR
VFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD
ISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAK
TTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADN
AGEEGGEAPQEPQS
ERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKG
PEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESR
VFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD
ISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAK
TTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADN
AGEEGGEAPQEPQS
protein accession :
AAH00329.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr,IP
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
