This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
GNAI3 purified MaxPab mouse polyclonal antibody (B01P)
catalog :
H00002773-B01P
quantity :
50 ug
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00002773-B01P
product name :
GNAI3 purified MaxPab mouse polyclonal antibody (B01P)
product description :
Mouse polyclonal antibody raised against a full-length human GNAI3 protein.
gene name :
GNAI3
gene alias :
87U6 FLJ26559
gene description :
guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3
genbank accession :
BC025285.1
immunogen :
GNAI3 (AAH25285.1, 1 a.a. ~ 354 a.a) full-length human protein.
immunogen sequence protein sequence :
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLL
GAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTI
QSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEG
VMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYL
NDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLY
FKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVL
AEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDL
FEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNR
RKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKEC
GLY
GAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTI
QSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEG
VMTPELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYL
NDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLY
FKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVL
AEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDL
FEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNR
RKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKEC
GLY
protein accession :
AAH25285.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,WB-Tr
size :
50 ug
autodate :
10/13/08
updatetime :
2/5/20 11:36
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
