This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FRZB monoclonal antibody (M02), clone 4E5
catalog :
H00002487-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4E5
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00002487-M02
product name :
FRZB monoclonal antibody (M02), clone 4E5
product description :
Mouse monoclonal antibody raised against a full-length recombinant FRZB.
clone name :
4E5
isotype :
IgG1 Kappa
gene name :
FRZB
gene alias :
FRE FRITZ FRP-3 FRZB-1 FRZB-PEN FRZB1 FZRB SFRP3 SRFP3 hFIZ
gene description :
frizzled-related protein
genbank accession :
NM_001463
immunogen :
FRZB (NP_001454, 102 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELP
VYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCK
CKPIRATQKTY*
VYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCK
CKPIRATQKTY*
protein accession :
NP_001454
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
100 ug
autodate :
2007-09-11
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
