This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FOXM1 monoclonal antibody (M01), clone 3A9
catalog :
H00002305-M01
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3A9
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00002305-M01
product name :
FOXM1 monoclonal antibody (M01), clone 3A9
product description :
Mouse monoclonal antibody raised against a partial recombinant FOXM1.
clone name :
3A9
isotype :
IgG2a Kappa
gene name :
FOXM1
gene alias :
FKHL16 FOXM1B HFH-11 HFH11 HNF-3 INS-1 MPHOSPH2 MPP-2 MPP2 PIG29 TGT3 TRIDENT
gene description :
forkhead box M1
genbank accession :
NM_202002
immunogen :
FOXM1 (NP_973731.1, 702 a.a. ~ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKP
GSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFP
GLDEDPLGPDNINWSQFIPELQ
GSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFP
GLDEDPLGPDNINWSQFIPELQ
protein accession :
NP_973731.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,WB-Tr
size :
50 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
