This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FHL1 monoclonal antibody (M05), clone 2F7
catalog :
H00002273-M05
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F7
reactivity :
human, rat
application :
western blot, ELISA
citations: 1
product information
catalog id :
H00002273-M05
product name :
FHL1 monoclonal antibody (M05), clone 2F7
product description :
Mouse monoclonal antibody raised against a partial recombinant FHL1.
clone name :
2F7
isotype :
IgG2a Kappa
gene name :
FHL1
gene alias :
FHL1B FLH1A KYO-T MGC111107 SLIM1 XMPMA bA535K18.1
gene description :
four and a half LIM domains 1
genbank accession :
NM_001449
immunogen :
FHL1 (NP_001440, 23 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
DGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFW
HDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK
CKGCFKAIVAGDQNVEYKGT
HDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK
CKGCFKAIVAGDQNVEYKGT
protein accession :
NP_001440
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2008-05-08
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
