This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FGFR2 monoclonal antibody (M03), clone 2C11
catalog :
H00002263-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C11
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00002263-M03
product name :
FGFR2 monoclonal antibody (M03), clone 2C11
product description :
Mouse monoclonal antibody raised against a partial recombinant FGFR2.
clone name :
2C11
isotype :
IgG2b Kappa
gene name :
FGFR2
gene alias :
BEK BFR-1 CD332 CEK3 CFD1 ECT1 FLJ98662 JWS K-SAM KGFR TK14 TK25
gene description :
fibroblast growth factor receptor 2
genbank accession :
BC039243
immunogen :
FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDL
DRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDS
VFSPDPMPYEPCLPQYPHINGSVKT
DRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDS
VFSPDPMPYEPCLPQYPHINGSVKT
protein accession :
AAH39243
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
